PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05102g08002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 242aa    MW: 28570.5 Da    PI: 4.8077
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05102g08002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.41.4e-11442341
                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                              i+++   + tf kR++ ++KK +ELS+L d+++++ii+ 
  Niben101Scf05102g08002.1  4 IQDHKTWKSTFPKRKACLIKKVSELSILGDIKACMIIYE 42
                              666667788***************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-4151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.989145IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.72E-11154IPR002100Transcription factor, MADS-box
PfamPF003197.3E-10445IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MELIQDHKTW KSTFPKRKAC LIKKVSELSI LGDIKACMII YEGNNYEVIS PYIKACMIIY  60
EGNNYEVISP QVWPNDPNEV QELINLYKNQ PIEERSKRAK TMCSFLENEK TKAEKLKKKI  120
KTEKYPCWDS RFNYLSEKEL RNLAEVLEKK IENAKGKSEF LKSYRNINQE IWDYPELMDN  180
FNQDNQFFQE LTADNVNSMG IWDNGQLSID DYEFGNSEYM KIETEEWSVN NGIIGSRMQA  240
ME
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598741.11e-128PREDICTED: agamous-like MADS-box protein AGL92
TrEMBLM1CN251e-55M1CN25_SOLTU; Uncharacterized protein
TrEMBLM1DA131e-56M1DA13_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000710013e-55(Solanum tuberosum)
STRINGPGSC0003DMT4000856764e-56(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.19e-12M-type_MADS family protein